PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100169040021
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family B3
Protein Properties Length: 322aa    MW: 37229.8 Da    PI: 9.3436
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100169040021genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B335.51.8e-112222931286
                                   HTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
                            B3  12 ksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                                   k+++  +pk+ ++e +++   + +l++ d +gr+We k++ +k  gr++ ++GWk+ ++an+  + D ++ ++ +
  Ote100169040021|100169040021 222 KRDNELIPKDVIAEQKLE--IPAKLVMVDGRGRKWEDKVKNWKD-GRVWCSRGWKSLCRANNTGADDACICEFLQ 293
                                   5566689****9999877..7889***************76666.589*********************988654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.43E-6101152IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS508637.584101148IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.103.7E-6102150IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.103.2E-13208293IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.55E-13209293IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS508639.037211307IPR003340B3 DNA binding domain
SMARTSM010190.0025215304IPR003340B3 DNA binding domain
PfamPF023625.7E-9222291IPR003340B3 DNA binding domain
CDDcd100172.45E-6227288No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MQSTSMAAFT RITSPPPLSP QISFTYSPAF LLLHCTSTAF SSSVHRHHRW WRAKRRRAAL  60
RSIFITLNHR DFHQRALHDC KELEMTKSSS ETCTTTRGPL RWREMEMNYG FKNGWPQFYE  120
ENCLEPTDFV MFQYVCGNLF DVRLIGRDAC EKKGLGGPRV VMKEEFCAXX XXXXXXXXXX  180
XXXXXXXXXX XXAAVDWYGE EIFKSGAAIQ PKNPYFVSRR RKRDNELIPK DVIAEQKLEI  240
PAKLVMVDGR GRKWEDKVKN WKDGRVWCSR GWKSLCRANN TGADDACICE FLQQPPHCTI  300
LHMRLQPLPA PASASSFSIY SV
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA10912264